CEM Corporation - Life Science - Medicinal, Scale up, Biosciences microwave chemistry

CEM’s Microwave Peptide Synthesizer Allows Mimotopes to Successfully Synthesize Difficult 52mer Peptide
Synthesis Not Previously Possible Under Conventional Conditions

“Phylogica gave multiple peptide companies a ‘shot at the title’ yet we all failed using conventional synthesizers. I’m pleased to say that with our CEM Liberty, we are successfully delivering long and difficult sequences to our customers”
-Mimotopes’ CSO, Dr Nick Ede

Australian biotechnology company Mimotopes, a wholly owned subsidiary of PharmAust (ASX:PAA), in a collaboration with Phylogica (ASX:PYC), has successfully utilized the CEM LibertyT Microwave Peptide Synthesizer to synthesize a long and difficult peptide sequence, derived from bacterial genomic sequences. Using the Liberty, Mimotopes was able to obtain a crude purity of ~ 65% with a total synthesis time of 48 hours. Previous attempts using conventional technology yielded < 5% crude purity with a significantly longer synthesis time.

Sequence: GRKKRRQRRRGKDSIRRRGENISSQEVEAVLMSHPEVVNAAVYPVRGDLPGD

LC/MS Trace at 214nm of the crude Phylomer® peptide product from the Liberty

In August 2005, Phylogica signed a partnering deal with Melbourne-based Mimotopes Pty Ltd, a global leader in the development of pre-clinical peptides for biological and pharmaceutical applications. Mimotopes’ proprietary technologies in peptide synthesis provide it with a unique ability to produce large libraries of long and unusual peptides, including Phylomer® peptides. Using their complementary technology platforms, Phylogica and Mimotopes are now working together to develop the next generation of peptide drugs.